• DRAMP ID

    • DRAMP02453
    • Peptide Name

    • S. litura moricin (Sl moricin; Insects, animals)
    • Source

    • Spodoptera litura (Lepidopteran insect)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • GKIPVKAIKKAGAAIGKGLRAINIASTAHDVYSFFKPKHKKK
    • Sequence Length

    • 42
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-negative bacteria: Pseudomonas aeruginosa (LD50=67.4 µg/ml), Escherichia coli JM109 (LD50=5.2 µg/ml);
      • Gram-positive bacteria: Staphylococcus aureus (LD50=2.7 µg/ml), Methicillin-resistant S. aureus (LD50=9.8 µg/ml), Micrococcus luteus (LD50=28.4 µg/ml), Bacillus thuringiensis HD-1 (LD50=0.5 µg/ml), Enterococcus faecium IFO3128 (LD50=6.2 µg/ml).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Alpha helix (1 helices; 31 residues)
    • Structure Description

    • The solution structure of Sl moricin is determined by two-dimensional (2D) 1H-nuclear magnetic resonance (NMR) spectroscopy and hybrid distance geometry-simulated annealing calculation. The tertiary structure reveales a long alpha-helix containing eight turns along nearly the full length of the peptide like that of moricin, confirming that Sl moricin is a new moricin-like antibacterial peptide.
    • Helical Wheel Diagram

    • DRAMP02453 helical wheel diagram
    • PDB ID

    • 1X22 resolved by NMR.
    • Predicted Structure

    • There is no predicted structure for DRAMP02453.
    • Formula

    • C208H348N60O50
    • Absent Amino Acids

    • CEMQW
    • Common Amino Acids

    • K
    • Mass

    • 4489.42
    • PI

    • 10.64
    • Basic Residues

    • 13
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 17
    • Net Charge

    • +12
    • Boman Index

    • -44.62
    • Hydrophobicity

    • -0.295
    • Aliphatic Index

    • 86.19
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1490
    • Absorbance 280nm

    • 36.34
    • Polar Residues

    • 9

DRAMP02453

DRAMP02453 chydropathy plot
    • Function

    • Sl moricin showes a broad antibacterial spectrum against Gram-positive and Gram-negative bacteria.
  • ·Literature 1
    • Title

    • Isolation, gene expression and solution structure of a novel moricin analogue, antibacterial peptide from a lepidopteran insect, Spodoptera litura.
    • Reference

    • Biochim Biophys Acta. 2005 Aug 31;1752(1):83-92.
    • Author

    • Oizumi Y, Hemmi H, Minami M, Asaoka A, Yamakawa M.