General Information

    • DRAMP ID

    • DRAMP02453

    • Peptide Name

    • S. litura moricin (Sl moricin; Insects, animals)

    • Source

    • Spodoptera litura (Lepidopteran insect)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GKIPVKAIKKAGAAIGKGLRAINIASTAHDVYSFFKPKHKKK

    • Sequence Length

    • 42

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Pseudomonas aeruginosa (LD50=67.4 µg/ml), Escherichia coli JM109 (LD50=5.2 µg/ml);
      • Gram-positive bacteria: Staphylococcus aureus (LD50=2.7 µg/ml), Methicillin-resistant S. aureus (LD50=9.8 µg/ml), Micrococcus luteus (LD50=28.4 µg/ml), Bacillus thuringiensis HD-1 (LD50=0.5 µg/ml), Enterococcus faecium IFO3128 (LD50=6.2 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Alpha helix (1 helices; 31 residues)

    • Structure Description

    • The solution structure of Sl moricin is determined by two-dimensional (2D) 1H-nuclear magnetic resonance (NMR) spectroscopy and hybrid distance geometry-simulated annealing calculation. The tertiary structure reveales a long alpha-helix containing eight turns along nearly the full length of the peptide like that of moricin, confirming that Sl moricin is a new moricin-like antibacterial peptide.

    • Helical Wheel Diagram

    • DRAMP02453 helical wheel diagram

    • PDB ID

    • 1X22 resolved by NMR.
  • 1X22-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP02453.

Physicochemical Information

    • Formula

    • C208H348N60O50

    • Absent Amino Acids

    • CEMQW

    • Common Amino Acids

    • K

    • Mass

    • 4489.42

    • PI

    • 10.64

    • Basic Residues

    • 13

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +12

    • Boman Index

    • -44.62

    • Hydrophobicity

    • -0.295

    • Aliphatic Index

    • 86.19

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1490

    • Absorbance 280nm

    • 36.34

    • Polar Residues

    • 9

DRAMP02453

DRAMP02453 chydropathy plot

Comments Information

    • Function

    • Sl moricin showes a broad antibacterial spectrum against Gram-positive and Gram-negative bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Isolation, gene expression and solution structure of a novel moricin analogue, antibacterial peptide from a lepidopteran insect, Spodoptera litura.

    • Reference

    • Biochim Biophys Acta. 2005 Aug 31;1752(1):83-92.

    • Author

    • Oizumi Y, Hemmi H, Minami M, Asaoka A, Yamakawa M.