General Information

    • DRAMP ID

    • DRAMP02454

    • Peptide Name

    • Theromacin (Arthropods, animals)

    • Source

    • Hirudo medicinalis (Medicinal leech)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GCFEDWSRCSPSTASATGVLWRSCDSYCKVCFKADRGECYDSPSLNCPHRLPNNKQCRCINARTAKDNRNPTCWA

    • Sequence Length

    • 75

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli ATCC 35218 (LD90=6.25 µg/ml);
      • Gram-positive bacteria: Staphylococcus aureus ATCC 12600 (LD90=25 µg/ml), Bacillus megaterium ATCC 14581 (MBC=0.2-0.39 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Structural features of Theromacin: the characteristic additional N-terminal helix and two long flexible loops separating the two helices.

    • Helical Wheel Diagram

    • DRAMP02454 helical wheel diagram

    • PDB ID

    • 2LN8 resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP02454.

Physicochemical Information

    • Formula

    • C353H544N112O111S10

    • Absent Amino Acids

    • M

    • Common Amino Acids

    • C

    • Mass

    • 8453.49

    • PI

    • 8.6

    • Basic Residues

    • 12

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +5

    • Boman Index

    • -204.47

    • Hydrophobicity

    • -0.764

    • Aliphatic Index

    • 36.53

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 20105

    • Absorbance 280nm

    • 271.69

    • Polar Residues

    • 33

DRAMP02454

DRAMP02454 chydropathy plot

Comments Information

    • Function

    • It showes antimicrobial activity against Gram-positive bacteria and Gram-negative bacteria in the low microgram concentration range.

    • PTM

    • Problely contains five disulfide bonds 2-9; 24-28; 31-73; 39-47; 57-59.

Literature Information

  • ·Literature 1

    • Title

    • Macin family of antimicrobial proteins combines antimicrobial and nerve repair activities.

    • Reference

    • J Biol Chem. 2012 Apr 20;287(17):14246-58.

    • Author

    • Jung S, Sönnichsen FD, Hung CW, Tholey A, Boidin-Wichlacz C, Haeusgen W, Gelhaus C, Desel C, Podschun R, Waetzig V, Tasiemski A, Leippe M, Grötzinger J.
  • ·Literature 2

    • Title

    • Antimicrobial peptides isolated from the medicinal leech.

    • Reference

    • Submitted (SEP-2007) to the EMBL/GenBank/DDBJ databases

    • Author

    • Schikorski D, Salzet M, Tasiemski A.