• DRAMP ID

    • DRAMP02462
    • Peptide Name

    • L-amino-acid oxidase (LAAO; LAO; snakes, reptils, animals)
    • Source

    • Naja oxiana (Central Asian cobra) (Oxus cobra)
    • Family

    • Belongs to the flavin monoamine oxidase family (FIG1 subfamily)
    • Gene

    • Not found
    • Sequence

    • DDRRSPLEECFQQNDYEEFLEIARNSQLYQESLREDSSYHLSFIESLKSDALFSYEKKFWEADGIHGGKVINDLSLIHDLPKREIQALCYPSIKK
    • Sequence Length

    • 95
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiparasitic
    • Target Organism

      • Gram-positive bacterium: Bacillus subtilis;
      • Gram-negative bacterium: E. coli.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02462 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02462.
    • Formula

    • C500H764N132O158S2
    • Absent Amino Acids

    • MT
    • Common Amino Acids

    • ELS
    • Mass

    • 11216.48
    • PI

    • 4.86
    • Basic Residues

    • 15
    • Acidic Residues

    • 19
    • Hydrophobic Residues

    • 29
    • Net Charge

    • -4
    • Boman Index

    • -235.37
    • Hydrophobicity

    • -0.762
    • Aliphatic Index

    • 81.16
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 13075
    • Absorbance 280nm

    • 139.1
    • Polar Residues

    • 24

DRAMP02462

DRAMP02462 chydropathy plot
    • Function

    • Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as antibacterial activity against both Gram-positive (B.subtilis) and Gram-negative (E.coli) bacteria, and inhibition of ADP- or collagen-induced platelet aggregation. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions. This protein may also induce hemorrhage, hemolysis, edema, apoptosis, and have antiparasitic activities.
    • Tissue specificity

    • Expressed by the venom gland.
    • Biophysicochemical properties

    • Kinetic parameters (KM=0.885 mM for L-Met; KM=0.051 mM for L-Phe; KM=0.147 mM for L-Trp; KM=0.75 mM for L-Leu)
  • ·Literature 1
    • Title

    • L-Amino acid oxidase from Naja naja oxiana venom.
    • Reference

    • Comp Biochem Physiol B Biochem Mol Biol. 2008 Apr;149(4):572-580.
    • Author

    • Samel M, Tõnismägi K, Rönnholm G, Vija H, Siigur J, Kalkkinen N, Siigur E.