• DRAMP ID

    • DRAMP02464
    • Peptide Name

    • L-amino-acid oxidase (LAAO, LAO; reptilia, animals)
    • Source

    • Bitis gabonica (Gaboon adder) (Gaboon viper)
    • Family

    • Belongs to the flavin monoamine oxidase family (FIG1 subfamily)
    • Gene

    • Unknown
    • Sequence

    • GPMRIPEKHRIVREYIRKFGLQLNEFVQETENAWYYIKNIRKKVHEVKKDPGLLKYPVKP
    • Sequence Length

    • 60
    • Evidence code

    • Transcript level
    • Biological Activity

    • Antibacterial, Antiparasitic, Antimicrobial
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Structure

    • Unknown
    • Structure Description

    • Unknown
    • DRAMP02464 helical wheel diagram
    • Formula

    • C339H538N94O85S
    • Absent Amino Acids

    • CS
    • Common Amino Acids

    • K
    • Mass

    • 8375.17
    • PI

    • 10.51
    • Basic Residues

    • 16
    • Acidic Residues

    • 7
    • Hydrophobic Residues

    • 18
    • Boman Index

    • -137.83
    • Hydrophobicity

    • -90
    • Aliphatic Index

    • 84.33
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 11460
    • Absorbance 280nm

    • 194.24
    • Polar Residues

    • 11

DRAMP02464

DRAMP02464 chydropathy plot
    • Function

    • Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, apoptosis of vascular endothelial cells or tumor cell lines, antibacterial and antiparasitic activities, as well as regulation of platelet aggregation. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions (By similarity).
  • Literature 1
    • Reference

    • Gene. 2004 Aug 4;337:55-69.
    • Author

    • Francischetti IM, My-Pham V, Harrison J, Garfield MK, Ribeiro JM.
    • Title

    • Bitis gabonica (Gaboon viper) snake venom gland: toward a catalog for the full-length transcripts (cDNA) and proteins.