• DRAMP ID

    • DRAMP02464
    • Peptide Name

    • L-amino-acid oxidase (LAAO, LAO; reptilia, animals)
    • Source

    • Bitis gabonica (Gaboon adder) (Gaboon viper)
    • Family

    • Belongs to the flavin monoamine oxidase family (FIG1 subfamily)
    • Gene

    • Not found
    • Sequence

    • GPMRIPEKHRIVREYIRKFGLQLNEFVQETENAWYYIKNIRKKVHEVKKDPGLLKYPVKP
    • Sequence Length

    • 60
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antibacterial, Antiparasitic
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02464 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02464.
    • Formula

    • C339H538N94O85S
    • Absent Amino Acids

    • CS
    • Common Amino Acids

    • K
    • Mass

    • 7322.64
    • PI

    • 9.93
    • Basic Residues

    • 16
    • Acidic Residues

    • 7
    • Hydrophobic Residues

    • 18
    • Net Charge

    • +9
    • Boman Index

    • -137.83
    • Hydrophobicity

    • -0.9
    • Aliphatic Index

    • 84.33
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 11460
    • Absorbance 280nm

    • 194.24
    • Polar Residues

    • 11

DRAMP02464

DRAMP02464 chydropathy plot
    • Function

    • Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, apoptosis of vascular endothelial cells or tumor cell lines, antibacterial and antiparasitic activities, as well as regulation of platelet aggregation. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions (By similarity).
  • ·Literature 1
    • Title

    • Bitis gabonica (Gaboon viper) snake venom gland: toward a catalog for the full-length transcripts (cDNA) and proteins.
    • Reference

    • Gene. 2004 Aug 4;337:55-69.
    • Author

    • Francischetti IM, My-Pham V, Harrison J, Garfield MK, Ribeiro JM.