General Information

    • DRAMP ID

    • DRAMP02469

    • Peptide Name

    • Alpha-lytic protease L1

    • Source

    • Lysobacter sp. (strain XL1)

    • Family

    • Belongs to the peptidase S1 family

    • Gene

    • Not found

    • Sequence

    • VNVLGGIEYSINNATLCSVGFSVRVFNYAEGAVRGLTQGNACMGRGDSGGSWFTLFERQYGL

    • Sequence Length

    • 62

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02469 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02469.

Physicochemical Information

    • Formula

    • C291H444N82O89S3

    • Absent Amino Acids

    • HKP

    • Common Amino Acids

    • G

    • Mass

    • 6611.4

    • PI

    • 6.21

    • Basic Residues

    • 4

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 22

    • Net Charge

    • 0

    • Boman Index

    • -62.82

    • Hydrophobicity

    • 0.108

    • Aliphatic Index

    • 78.55

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 10095

    • Absorbance 280nm

    • 165.49

    • Polar Residues

    • 29

DRAMP02469

DRAMP02469 chydropathy plot

Comments Information

    • Function

    • Has bacteriolytic activity.

    • Biophysicochemical properties

    • pH dependence (Optimum pH is 8.0. Active from pH 7.0 to 11.0); Temperature dependence (Optimum temperature is 70 degrees Celsius).

Literature Information

  • ·Literature 1

    • Title

    • Identification of extracellular bacteriolytic enzymes from Lysobacter sp. XL1.

    • Reference

    • Submitted (APR-2007) to UniProtKB

    • Author

    • Muranova T.A, Stepnaya O.A, Tsfasman I.M, Kulaev I.S.