• DRAMP ID

    • DRAMP02472
    • Peptide Name

    • Turmerin (Plants)
    • Source

    • Curcuma longa (Turmeric) (Curcuma domestica)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • LCPLDVLQLSSELLDIDGNEVEASRILSDITAFGGIRCPLTVVQSRGIGTIISSPYRFIAEGHPLSLKDMDGWFRVSDDEFNNYK
    • Sequence Length

    • 85
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Anti-cancer, Antiplasmodial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02472.
    • Formula

    • C418H658N110O131S3
    • Absent Amino Acids

    • ?
    • Common Amino Acids

    • LS
    • Mass

    • 9416.66
    • PI

    • 4.43
    • Basic Residues

    • 8
    • Acidic Residues

    • 13
    • Hydrophobic Residues

    • 31
    • Net Charge

    • -5
    • Boman Index

    • -123.83
    • Hydrophobicity

    • 0
    • Aliphatic Index

    • 103.18
    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 8605
    • Absorbance 280nm

    • 102.44
    • Polar Residues

    • 26

DRAMP02472

    • Function

    • Has anticarcinogenic activity, prevents transformation of DMBA-treated JB6 cells. Has antipromoter activity, prevents promotion by tetradecanoyl phorbal acetate (TPA) in JB6 cells. Prevents tertiary butyl hydroperoxide-induced mutagenesis. Protects AT base pairs and shows antimutagenesis activity in TA102 and TA104 S.typhimurium mutagenesis tests. Inhibits paw edema formation induced by phospholipase A2 in Swiss Wistar mice. Prevents the release of arachidonate, the parent compound for the synthesis of prostaglandins and prostacyclins. Has antimalarial activity, kills P. falciparum. Has antivenom activity, nullifies the lethal effects of N.naja venom and inhibits phospholipase A2 present in N.naja venom. Has antifungal activity, inhibits cilia formation by A.niger. Is not toxic or allergenic.
    • Sequence similarities

    • Belongs to the protease inhibitor I3 (leguminous Kunitz-type inhibitor) family. [View classification]
    • Biophysicochemical properties

    • Temperature dependence (Stable for 7 days at room temperature and for 30 days at 4 degrees Celsius. Remains active after incubation at 100 degrees Celsius for 3 hours).
    • Caution

    • The order of the first peptide shown is Not found.
  • ·Literature 1
    • Title

    • Turmerin: a water soluble antioxidant peptide from turmeric [Curcuma longa].
    • Reference

    • Arch Biochem Biophys. 1992 Feb 1;292(2):617-623.
    • Author

    • Srinivas L, Shalini VK, Shylaja M.
  • ·Literature 2
    • Title

    • New biological activity against phospholipase A2 by Turmerin, a protein from Curcuma longa L.
    • Reference

    • Biol Chem. 2008 Mar;389(3):299-303.
    • Author

    • Chethankumar M, Srinivas L.