General Information

    • DRAMP ID

    • DRAMP02475

    • Peptide Name

    • Nawaprin (Snakes, reptiles, animals)

    • Source

    • Naja nigricollis (Black-necked spitting cobra)

    • Family

    • Belongs to the snake waprin family

    • Gene

    • Not found

    • Sequence

    • NEKSGSCPDMSMPIPPLGICKTLCNSDSGCPNVQKCCKNGCGFMTCTTPVP

    • Sequence Length

    • 51

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Cell membrane

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02475 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP02475.

Physicochemical Information

    • Formula

    • C216H354N60O72S11

    • Absent Amino Acids

    • AHRWY

    • Common Amino Acids

    • CP

    • Mass

    • 5296.21

    • PI

    • 7.69

    • Basic Residues

    • 4

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +1

    • Boman Index

    • -53.1

    • Hydrophobicity

    • -0.198

    • Aliphatic Index

    • 41.96

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 500

    • Absorbance 280nm

    • 10

    • Polar Residues

    • 26

DRAMP02475

DRAMP02475 chydropathy plot

Comments Information

    • Function

    • Damages membranes of susceptible bacteria. Does not inhibit the proteinases elastase and cathepsin G (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Identification of a novel family of proteins in snake venoms. Purification and structural characterization of nawaprin from Naja nigricollis snake venom.

    • Reference

    • J Biol Chem. 2003 Oct 10;278(41):40097-104.

    • Author

    • Torres AM, Wong HY, Desai M, Moochhala S, Kuchel PW, Kini RM.