General Information

    • DRAMP ID

    • DRAMP02476

    • Peptide Name

    • Waprin-Phi3 (Snakes, reptiles, animals)

    • Source

    • Philodryas olfersii (Green snake)

    • Family

    • Belongs to the snake waprin family

    • Gene

    • Not found

    • Sequence

    • KTTKQLRLPKVKPGECPKVKIPPDYPCNQYCVWDFDCEGNKKCCPVGCAKECFPPGPL

    • Sequence Length

    • 58

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Cell membrane

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02476 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02476.

Physicochemical Information

    • Formula

    • C289H453N75O79S8

    • Absent Amino Acids

    • HMS

    • Common Amino Acids

    • PK

    • Mass

    • 6498.71

    • PI

    • 8.67

    • Basic Residues

    • 10

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +4

    • Boman Index

    • -81.3

    • Hydrophobicity

    • -0.638

    • Aliphatic Index

    • 48.62

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 8980

    • Absorbance 280nm

    • 157.54

    • Polar Residues

    • 18

DRAMP02476

DRAMP02476 chydropathy plot

Comments Information

    • PTM

    • four disulfide bonds

    • Damages membranes of susceptible bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Evolution of an arsenal: structural and functional diversification of the venom system in the advanced snakes (Caenophidia).

    • Reference

    • Mol Cell Proteomics. 2008 Feb;7(2):215-246.

    • Author

    • Fry BG, Scheib H, van der Weerd L, Young B, McNaughtan J, Ramjan SF, Vidal N, Poelmann RE, Norman JA.