• DRAMP ID

    • DRAMP02478
    • Peptide Name

    • L-amino-acid oxidase (Bm-LAO; LAAO; LAO; Snakes, reptiles, animals)
    • Source

    • Bothropoides matogrossensis (Pitviper) (Bothrops neuwiedimatogrossensis)
    • Family

    • Belongs to the flavin monoamine oxidase family (FIG1 subfamily)
    • Gene

    • Not found
    • Sequence

    • IKFEPPLPPKKAHKKFWEDDGIYYPPNHNFP
    • Sequence Length

    • 31
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiparasitic
    • Target Organism

      • Gram-positive bacteria: Bacillus subtilis strain ATCC 6633 (MIC=32 µM), Enterococcus faecalis strain ATCC 12953 (MIC=32 µM), Staphylococcus aureus strain ATCC 29213 (MIC=32 µM), Streptococcus pyogenes strain ATCC 19615 (MIC=8 µM);
      • Gram-negative bacteria: Escherichia coli strain ATCC 8739 (MIC=4 µM), Klebsiella pneumoniaee strain ATCC 13885 (MIC=2 µM), Proteus mirabilis strain ATCC 25933 (MIC=2 µM), Pseudomonas aeruginosa strain ATCC 15442 (MIC=8 µM), Salmonella typhimurium strain ATCC 14028 (MIC=8 µM).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02478 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02478.
    • Formula

    • C182H257N43O44
    • Absent Amino Acids

    • CMQRSTV
    • Common Amino Acids

    • P
    • Mass

    • 3751.3
    • PI

    • 8.32
    • Basic Residues

    • 7
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +3
    • Boman Index

    • -52.91
    • Hydrophobicity

    • -1.258
    • Aliphatic Index

    • 40.97
    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8480
    • Absorbance 280nm

    • 282.67
    • Polar Residues

    • 5

DRAMP02478

DRAMP02478 chydropathy plot
    • Function

    • Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, antibacterial and antiparasitic activities, as well as regulation of platelet aggregation. Its effect on platelets is controversial, since it either induces aggregation or inhibits agonist-induced aggregation. These different effects are probably due to different experimental conditions (By similarity).
    • Tissue specificity

    • Expressed by the venom gland.
  • ·Literature 1
    • Title

    • Evaluation of an antimicrobial L-amino acid oxidase and peptide derivatives from Bothropoides mattogrosensis pitviper venom.
    • Reference

    • PLoS One. 2012;7(3):e33639.
    • Author

    • Okubo BM, Silva ON, Migliolo L, Gomes DG, Porto WF, Batista CL, Ramos CS, Holanda HH, Dias SC, Franco OL, Moreno SE.