General Information

    • DRAMP ID

    • DRAMP02480

    • Peptide Name

    • Omwaprin-b (Oxywaprin-b; Snakes, reptiles, animals)

    • Source

    • Oxyuranus microlepidotus (Inland taipan)

    • Family

    • Belongs to the snake waprin family

    • Gene

    • Not found

    • Sequence

    • KDRPKKPGLCPPRPQKPCVKECKNDWSCPGQQKCCNYGCIDECRDPIFVN

    • Sequence Length

    • 50

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antimalarial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02480 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02480.

Physicochemical Information

    • Formula

    • C243H387N73O71S8

    • Absent Amino Acids

    • AHMT

    • Common Amino Acids

    • CPK

    • Mass

    • 5723.67

    • PI

    • 8.7

    • Basic Residues

    • 10

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +4

    • Boman Index

    • -130.98

    • Hydrophobicity

    • -1.116

    • Aliphatic Index

    • 35

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 7490

    • Absorbance 280nm

    • 152.86

    • Polar Residues

    • 16

DRAMP02480

DRAMP02480 chydropathy plot

Comments Information

    • Function

    • Damages membranes of susceptible bacteria. Does not inhibit the proteinases elastase and cathepsin G (By similarity).

    • Tissue specificity

    • Expressed by the venom gland.

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Common evolution of waprin and Kunitz-like toxin families in Australian venomous snakes.

    • Reference

    • Cell Mol Life Sci. 2008 Dec;65(24):4039-4054.

    • Author

    • St Pierre L, Earl ST, Filippovich I, Sorokina N, Masci PP, De Jersey J, Lavin MF.