General Information

    • DRAMP ID

    • DRAMP02482

    • Peptide Name

    • Omwaprin-a (Oxywaprin; Oxywaprin-a; Snakes, reptiles, animals)

    • Source

    • Oxyuranus microlepidotus (Inland taipan)

    • Family

    • Belongs to the snake waprin family

    • Gene

    • Not found

    • Sequence

    • KDRPKKPGLCPPRPQKPCVKECKNDDSCPGQQKCCNYGCKDECRDPIFVG

    • Sequence Length

    • 50

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Bacillus megaterium, Bacillus anthracis, Staphylococcus warneri.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Cell membrane

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Omwaprin is closest in structure to the 50 amino acid residue C-terminal WAP domain of the human protein secretory leukocyte protease inhibitor (SLPI) (PDB ID: 2Z7F). This domain of SLPI has eight Cys residues that align well with the Cys residues of omwaprin, suggesting a similar fold.

    • Helical Wheel Diagram

    • DRAMP02482 helical wheel diagram

    • PDB ID

    • 3NGG resolved by NMR.
  • 3NGG-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP02482.

Physicochemical Information

    • Formula

    • C234H380N72O72S8

    • Absent Amino Acids

    • AHMTW

    • Common Amino Acids

    • CKP

    • Mass

    • 5610.51

    • PI

    • 8.69

    • Basic Residues

    • 11

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 5

    • Net Charge

    • +4

    • Boman Index

    • -144.92

    • Hydrophobicity

    • -1.274

    • Aliphatic Index

    • 27.2

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 1990

    • Absorbance 280nm

    • 40.61

    • Polar Residues

    • 16

DRAMP02482

DRAMP02482 chydropathy plot

Comments Information

    • Function

    • Damages membranes of susceptible bacteria. Has antibacterial activity against the Gram-positive bacteria. Has no antibacterial activity against the Gram-positive bacteria.

    • Tissue specificity

    • Expressed by the venom gland.

    • Domain

    • Contains 1 WAP domain.

    • PTM

    • Contains four disulfide bonds 10-35; 18-39; 22-34; 28-43.

Literature Information

  • ·Literature 1

    • Title

    • Antimicrobial activity of omwaprin, a new member of the waprin family of snake venom proteins.

    • Reference

    • Biochem J. 2007 Feb 15;402(1):93-104.

    • Author

    • Nair DG, Fry BG, Alewood P, Kumar PP, Kini RM.
  • ·Literature 2

    • Title

    • Determination of the X-ray structure of the snake venom protein omwaprin by total chemical synthesis and racemic protein crystallography.

    • Reference

    • Protein Sci. 2010 Oct;19(10):1840-1849.

    • Author

    • Banigan JR, Mandal K, Sawaya MR, Thammavongsa V, Hendrickx AP, Schneewind O, Yeates TO, Kent SB.