General Information

    • DRAMP ID

    • DRAMP02484

    • Peptide Name

    • Waprin-Thr1 (Snakes, reptiles, animals)

    • Source

    • Thrasops jacksonii (Jackson's black tree snake)

    • Family

    • Belongs to the snake waprin family

    • Gene

    • Not found

    • Sequence

    • ENEKAGSCPDVNQPIPPLGLCRNMCESDSGCPNNEKCCKNGCGFMTCSRPR

    • Sequence Length

    • 51

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Cell membrane

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02484 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02484.

Physicochemical Information

    • Formula

    • C218H354N70O76S10

    • Absent Amino Acids

    • HWY

    • Common Amino Acids

    • C

    • Mass

    • 5492.23

    • PI

    • 6.35

    • Basic Residues

    • 6

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 6

    • Net Charge

    • 0

    • Boman Index

    • -124.41

    • Hydrophobicity

    • -0.814

    • Aliphatic Index

    • 30.59

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 500

    • Absorbance 280nm

    • 10

    • Polar Residues

    • 24

DRAMP02484

DRAMP02484 chydropathy plot

Comments Information

    • Function

    • Damages membranes of susceptible bacteria. Does not inhibit the proteinases elastase and cathepsin G (By similarity).

    • PTM

    • Contains four disulfide bonds 8-38; 21-42; 25-37; 31-47 (By similarity).

    • Tissue specificity

    • Expressed by the venom gland.

    • Domain

    • Contains 1 WAP domain.

Literature Information

  • ·Literature 1

    • Title

    • Evolution of an arsenal: structural and functional diversification of the venom system in the advanced snakes (Caenophidia).

    • Reference

    • Mol Cell Proteomics. 2008 Feb;7(2):215-246.

    • Author

    • Fry BG, Scheib H, van der Weerd L, Young B, McNaughtan J, Ramjan SF, Vidal N, Poelmann RE, Norman JA.