• DRAMP ID

    • DRAMP02487
    • Peptide Name

    • Waprin-Enh1 (Snakes, reptiles, animals)
    • Source

    • Enhydris polylepis (Macleay's water snake)
    • Family

    • Belongs to the snake waprin family
    • Gene

    • Not found
    • Sequence

    • KILFGCGISPGNPFPCSLPGLTGNRCRRDYDCPQTLRCCNFRCSRSCRIPPVLPWSCPRNPFKCTIPGIDRCRYDYDCPGRQRCCYYSCSRICK
    • Sequence Length

    • 94
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Cell membrane
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02487 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02487.
    • Formula

    • C460H721N143O126S16
    • Absent Amino Acids

    • AEHM
    • Common Amino Acids

    • C
    • Mass

    • 10783.63
    • PI

    • 9.12
    • Basic Residues

    • 16
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 17
    • Net Charge

    • +11
    • Boman Index

    • -224.59
    • Hydrophobicity

    • -0.472
    • Aliphatic Index

    • 48.72
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 13950
    • Absorbance 280nm

    • 150
    • Polar Residues

    • 42

DRAMP02487

DRAMP02487 chydropathy plot
    • Function

    • Damages membranes of susceptible bacteria. Does not inhibit the proteinases elastase and cathepsin G (By similarity).
    • PTM

    • Contains eight disulfide bonds (By similarity).
    • Tissue specificity

    • Expressed by the venom gland.
    • Domain

    • Contains 2 WAP domain.
  • ·Literature 1
    • Title

    • Evolution of an arsenal: structural and functional diversification of the venom system in the advanced snakes (Caenophidia).
    • Reference

    • Mol Cell Proteomics. 2008 Feb;7(2):215-246.
    • Author

    • Fry BG, Scheib H, van der Weerd L, Young B, McNaughtan J, Ramjan SF, Vidal N, Poelmann RE, Norman JA.