General Information

    • DRAMP ID

    • DRAMP02487

    • Peptide Name

    • Waprin-Enh1 (Snakes, reptiles, animals)

    • Source

    • Enhydris polylepis (Macleay's water snake)

    • Family

    • Belongs to the snake waprin family

    • Gene

    • Not found

    • Sequence

    • KILFGCGISPGNPFPCSLPGLTGNRCRRDYDCPQTLRCCNFRCSRSCRIPPVLPWSCPRNPFKCTIPGIDRCRYDYDCPGRQRCCYYSCSRICK

    • Sequence Length

    • 94

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Cell membrane

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02487 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02487.

Physicochemical Information

    • Formula

    • C460H721N143O126S16

    • Absent Amino Acids

    • AEHM

    • Common Amino Acids

    • C

    • Mass

    • 10783.63

    • PI

    • 9.12

    • Basic Residues

    • 16

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +11

    • Boman Index

    • -224.59

    • Hydrophobicity

    • -0.472

    • Aliphatic Index

    • 48.72

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 13950

    • Absorbance 280nm

    • 150

    • Polar Residues

    • 42

DRAMP02487

DRAMP02487 chydropathy plot

Comments Information

    • Function

    • Damages membranes of susceptible bacteria. Does not inhibit the proteinases elastase and cathepsin G (By similarity).

    • PTM

    • Contains eight disulfide bonds (By similarity).

    • Tissue specificity

    • Expressed by the venom gland.

    • Domain

    • Contains 2 WAP domain.

Literature Information

  • ·Literature 1

    • Title

    • Evolution of an arsenal: structural and functional diversification of the venom system in the advanced snakes (Caenophidia).

    • Reference

    • Mol Cell Proteomics. 2008 Feb;7(2):215-246.

    • Author

    • Fry BG, Scheib H, van der Weerd L, Young B, McNaughtan J, Ramjan SF, Vidal N, Poelmann RE, Norman JA.