General Information

    • DRAMP ID

    • DRAMP02512

    • Peptide Name

    • L-amino-acid oxidase (Casca LAO, LAAO, LAO; Snakes, reptiles, animals)

    • Source

    • Crotalus durissus cascavella (Northeastern Brazilian rattlesnake)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • ADDRNPLEQCFRETDYEEFLEIARNNLKATSNPKHVVIVGAGMAGLSAAYVLSGGGHQVTV

    • Sequence Length

    • 61

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antiparasitic, Cytotoxic

    • Target Organism

    • Xanthomonas axonopodis pv passiflorae, Streptococcus mutans, Leishmania amazonensis.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02512 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02512.

Physicochemical Information

    • Formula

    • C285H450N82O92S2

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • AGV

    • Mass

    • 6561.32

    • PI

    • 5.08

    • Basic Residues

    • 7

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 22

    • Net Charge

    • -1

    • Boman Index

    • -94.64

    • Hydrophobicity

    • -0.223

    • Aliphatic Index

    • 84.75

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 2980

    • Absorbance 280nm

    • 49.67

    • Polar Residues

    • 19

DRAMP02512

DRAMP02512 chydropathy plot

Comments Information

    • Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions. This protein may also induce hemorrhage, hemolysis, and edema. Also has parasiticidal activities against leishmania, as a result of enzyme-catalyzed hydrogen peroxide production, and the 50% inhibitory concentration was estimated in 2.39 microg/ml.

Literature Information

  • ·Literature 1

    • Title

    • Isolation of a new L-amino acid oxidase from Crotalus durissus cascavella venom.

    • Reference

    • Toxicon. 2006 Jan;47(1):47-57.

    • Author

    • Toyama MH, Toyama Dde O, Passero LF, Laurenti MD, Corbett CE, Tomokane TY, Fonseca FV, Antunes E, Joazeiro PP, Beriam LO, Martins MA, Monteiro HS, Fonteles MC.