• DRAMP ID

    • DRAMP02512
    • Peptide Name

    • L-amino-acid oxidase (Casca LAO, LAAO, LAO; Snakes, reptiles, animals)
    • Source

    • Crotalus durissus cascavella (Northeastern Brazilian rattlesnake)
    • Family

    • Unknown
    • Gene

    • Unknown
    • Sequence

    • ADDRNPLEQCFRETDYEEFLEIARNNLKATSNPKHVVIVGAGMAGLSAAYVLSGGGHQVTV
    • Sequence Length

    • 61
    • Evidence code

    • Protein level
    • Biological Activity

    • Antibacterial, Antiparasitic, Cytotoxic, Antimicrobial
    • Target Organism

      • Xanthomonas axonopodis pv passiflorae, Streptococcus mutans, Leishmania amazonensis.
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Structure

    • Unknown
    • Structure Description

    • Unknown
    • DRAMP02512 helical wheel diagram
    • Formula

    • C285H450N82O92S2
    • Absent Amino Acids

    • W
    • Common Amino Acids

    • AGV
    • Mass

    • 7631.74
    • PI

    • 4.88
    • Basic Residues

    • 7
    • Acidic Residues

    • 8
    • Hydrophobic Residues

    • 22
    • Boman Index

    • -94.64
    • Hydrophobicity

    • -22.3
    • Aliphatic Index

    • 84.75
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 2980
    • Absorbance 280nm

    • 49.67
    • Polar Residues

    • 19

DRAMP02512

DRAMP02512 chydropathy plot
    • Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions. This protein may also induce hemorrhage, hemolysis, and edema. Also has parasiticidal activities against leishmania, as a result of enzyme-catalyzed hydrogen peroxide production, and the 50% inhibitory concentration was estimated in 2.39 microg/ml.

  • Literature 1
    • Reference

    • Toxicon. 2006 Jan;47(1):47-57.
    • Author

    • Toyama MH, Toyama Dde O, Passero LF, Laurenti MD, Corbett CE, Tomokane TY, Fonseca FV, Antunes E, Joazeiro PP, Beriam LO, Martins MA, Monteiro HS, Fonteles MC.
    • Title

    • Isolation of a new L-amino acid oxidase from Crotalus durissus cascavella venom.