General Information

    • DRAMP ID

    • DRAMP02516

    • Peptide Name

    • Cc-CATH2

    • Source

    • Coturnix coturnix

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • LVQRGRFGRFLKKVRRFIPKVIIAAQIGSRFG

    • Sequence Length

    • 32

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02516 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02516.

Physicochemical Information

    • Formula

    • C173H289N55O36

    • Absent Amino Acids

    • CDEHMNTWY

    • Common Amino Acids

    • R

    • Mass

    • 3715.54

    • PI

    • 12.7

    • Basic Residues

    • 9

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +9

    • Boman Index

    • -59.71

    • Hydrophobicity

    • 0.103

    • Aliphatic Index

    • 106.56

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 5

DRAMP02516

DRAMP02516 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Gene cloning, expression, and characterization of avian cathelicidin orthologue, Cc-CATHs, from Coturnix coturnix.

    • Reference

    • FEBS J. 2011 May;278(9):1573-1584.

    • Author

    • Feng F, Chen C, Zhu W, He W, Guang H, Li Z, Wang D, Liu J, Chen M, Wang Y, Yu H.