General Information

    • DRAMP ID

    • DRAMP02535

    • Peptide Name

    • CRISPR-associated endoribonuclease Cas2 2 (Antiviral defensin)

    • Source

    • Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 /P2)

    • Family

    • Belongs to the CRISPR-associated endoribonuclease Cas2 prote

    • Gene

    • cas22

    • Sequence

    • MKLLVVYDVSDDSKRNKLANNLKKLGLERIQRSAFEGDIDSQRVKDLVRVVKLIVDTNTDIVHIIPLGIRDWERRIVIGREGLEEWLV

    • Sequence Length

    • 88

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Metal-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02535 helical wheel diagram

    • PDB ID

    • 3EXC resolved by X-ray.

    • Predicted Structure

    • There is no predicted structure for DRAMP02535.

Physicochemical Information

    • Formula

    • C455H760N132O132S

    • Absent Amino Acids

    • C

    • Common Amino Acids

    • LV

    • Mass

    • 10223.9

    • PI

    • 8.06

    • Basic Residues

    • 17

    • Acidic Residues

    • 15

    • Hydrophobic Residues

    • 36

    • Net Charge

    • +2

    • Boman Index

    • -192.5

    • Hydrophobicity

    • -0.216

    • Aliphatic Index

    • 127.16

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12490

    • Absorbance 280nm

    • 143.56

    • Polar Residues

    • 16

DRAMP02535

DRAMP02535 chydropathy plot

Comments Information

    • Function

    • CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • The complete genome of the crenarchaeon Sulfolobus solfataricus P2.

    • Reference

    • Proc Natl Acad Sci U S A. 2001 Jul 3;98(14):7835-7840.

    • Author

    • She Q, Singh RK, Confalonieri F, Zivanovic Y, Allard G, Awayez MJ, Chan-Weiher CC, Clausen IG, Curtis BA, De Moors A, Erauso G, Fletcher C, Gordon PM, Heikamp-de Jong I, Jeffries AC, Kozera CJ, Medina N, Peng X, Thi-Ngoc HP, Redder P, Schenk ME, Theriault C, Tolstrup N, Charlebois RL, Doolittle WF, Duguet M, Gaasterland T, Garrett RA, Ragan MA, Sensen CW, Van der Oost J.
  • ·Literature 2

    • Title

    • A novel family of sequence-specific endoribonucleases associated with the clustered regularly interspaced short palindromic repeats.

    • Reference

    • J Biol Chem. 2008 Jul 18;283(29):20361-71.

    • Author

    • Beloglazova N, Brown G, Zimmerman MD, Proudfoot M, Makarova KS, Kud
  • ·Literature 3

    • Title

    • Structure of the RNA'se SSO8090 from Sulfolobus solfataricus.

    • Reference

    • To be Published

    • Author