General Information

    • DRAMP ID

    • DRAMP02537

    • Peptide Name

    • CRISPR-associated endonuclease Cas2 2 (Antiviral defensin)

    • Source

    • Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)

    • Family

    • Belongs to the CRISPR-associated endoribonuclease Cas2 prote

    • Gene

    • cas2b

    • Sequence

    • MGKRLYAVAYDIPDDTRRVKLANLLKSYGERVQLSVFECYLDERLLEDLRRRARRLLDLGQDALRIYPVAGQVEVLGVGPLPELREVQVL

    • Sequence Length

    • 90

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Metal-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02537 helical wheel diagram

    • PDB ID

    • 1ZPW resolved by X-ray.

    • Predicted Structure

    • There is no predicted structure for DRAMP02537.

Physicochemical Information

    • Formula

    • C463H764N134O132S2

    • Absent Amino Acids

    • HW

    • Common Amino Acids

    • L

    • Mass

    • 10384.1

    • PI

    • 7.86

    • Basic Residues

    • 15

    • Acidic Residues

    • 14

    • Hydrophobic Residues

    • 36

    • Net Charge

    • +1

    • Boman Index

    • -186.28

    • Hydrophobicity

    • -0.18

    • Aliphatic Index

    • 121.22

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7450

    • Absorbance 280nm

    • 83.71

    • Polar Residues

    • 16

DRAMP02537

DRAMP02537 chydropathy plot

Comments Information

    • Function

    • CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • The genome sequence of the extreme thermophile Thermus thermophilus.

    • Reference

    • Nat Biotechnol. 2004 May;22(5):547-553.

    • Author

    • Henne A, Brüggemann H, Raasch C, Wiezer A, Hartsch T, Liesegang H, Johann A, Lienard T, Gohl O, Martinez-Arias R, Jacobi C, Starkuviene V, Schlenczeck S, Dencker S, Huber R, Klenk HP, Kramer W, Merkl R, Gottschalk G, Fritz HJ.
  • ·Literature 2

    • Title

    • Double-stranded endonuclease activity in Bacillus halodurans clustered regularly interspaced short palindromic repeats (CRISPR)-associated Cas2 protein.

    • Reference

    • J Biol Chem. 2012 Oct 19;287(43):35943-52.

    • Author

    • Nam KH, Ding F, Haitjema C, Huang Q, DeLisa MP, Ke A.
  • ·Literature 3

    • Title

    • Crystal structure of a hypothetical protein TT1823 from Thermus thermophilus.

    • Reference

    • To be Published

    • Author

    • Ihsanawati, Murayama K, Shirouzu M, Yokoyama S.