General Information

    • DRAMP ID

    • DRAMP02539

    • Peptide Name

    • CRISPR-associated endoribonuclease Cas2 3 (Antiviral defensin)

    • Source

    • Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)

    • Family

    • Belongs to the CRISPR-associated endoribonuclease Cas2 prote

    • Gene

    • cas2-3

    • Sequence

    • MKMFTVISYDIVDDQRRTSVMKVLKGYGVRVQYSVFEAILDAREFHDLSNQLRKIIDPGQDSIRCYRLDQVAAQRTVIYGIGLTTTDPTHYMV

    • Sequence Length

    • 93

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Metal-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02539 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02539.

Physicochemical Information

    • Formula

    • C477H762N132O141S5

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • VD

    • Mass

    • 10762.4

    • PI

    • 7.88

    • Basic Residues

    • 14

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 31

    • Net Charge

    • +3

    • Boman Index

    • -177.85

    • Hydrophobicity

    • -0.176

    • Aliphatic Index

    • 94.19

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8940

    • Absorbance 280nm

    • 97.17

    • Polar Residues

    • 25

DRAMP02539

DRAMP02539 chydropathy plot

Comments Information

    • Function

    • CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Complete sequence of Chloroflexus aurantiacus J-10-fl.

    • Reference

    • Submitted (DEC-2007) to the EMBL/GenBank/DDBJ databases

    • Author

    • Copeland A, Lucas S, Lapidus, Barry K, Glavina del Rio T, Hammon N, Israni S, Dalin E, Tice H, Pitluck S, Chertkov O, Brettin T, Bruce D, Detter JC, Han C, Schmutz J, Larimer F, Land M, Hauser L, Kyrpides N, Mikhailova N, Pierson BK, Blankenship RE, Richardson P.