General Information

    • DRAMP ID

    • DRAMP02562

    • Peptide Name

    • CRISPR-associated endoribonuclease Cas2 (Antiviral defensin)

    • Source

    • Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

    • Family

    • Belongs to the CRISPR-associated endoribonuclease Cas2 prote

    • Gene

    • cas2

    • Sequence

    • MYIVVVYDVGVERVNKVKKFLRMHLNWVQNSVFEGEVTLAEFERIKEGLKKIIDENSDSVIIYKLRSMPPRETLGIEKNPIEEII

    • Sequence Length

    • 85

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Metal-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02562 helical wheel diagram

    • PDB ID

    • 2I0X resolved by X-ray.

    • Predicted Structure

    • There is no predicted structure for DRAMP02562.

Physicochemical Information

    • Formula

    • C453H733N117O129S3

    • Absent Amino Acids

    • C

    • Common Amino Acids

    • EVI

    • Mass

    • 9978.69

    • PI

    • 5.84

    • Basic Residues

    • 14

    • Acidic Residues

    • 14

    • Hydrophobic Residues

    • 32

    • Net Charge

    • 0

    • Boman Index

    • -135.58

    • Hydrophobicity

    • -0.151

    • Aliphatic Index

    • 112.12

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 9970

    • Absorbance 280nm

    • 118.69

    • Polar Residues

    • 18

DRAMP02562

DRAMP02562 chydropathy plot

Comments Information

    • Function

    • CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Divergence of the hyperthermophilic archaea Pyrococcus furiosus and P. horikoshii inferred from complete genomic sequences.

    • Reference

    • Genetics. 1999 Aug;152(4):1299-1305.

    • Author

    • Maeder DL, Weiss RB, Dunn DM, Cherry JL, González JM, DiRuggiero J, Robb FT.
  • ·Literature 2

    • Title

    • Crystal Structure of Hypothetical Protein Pf1117 from Pyrococcus furiosus.

    • Reference

    • Submitted (AUG-2006) to the PDB data bank.

    • Author

    • Chen LQ, Fu ZQ, Hwang J, Chang J, Chen L, Wang Y, Zhang H, Liu ZJ, Rose JP, WangBC.