General Information

    • DRAMP ID

    • DRAMP02564

    • Peptide Name

    • CRISPR-associated endoribonuclease Cas2 (Antiviral defensin)

    • Source

    • Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

    • Family

    • Belongs to the CRISPR-associated endoribonuclease Cas2 prote

    • Gene

    • cas2

    • Sequence

    • MYVIMVYDVNEKRVAKILKIARKYLKWVQNSVLEGELSPGKYEKLKLEVSRLIDEKEDSVRFYVMDSQKVFNLETLGVEKGEDGFIF

    • Sequence Length

    • 87

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Metal-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02564 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02564.

Physicochemical Information

    • Formula

    • C468H746N116O134S3

    • Absent Amino Acids

    • CH

    • Common Amino Acids

    • KVE

    • Mass

    • 10237.95

    • PI

    • 6.3

    • Basic Residues

    • 15

    • Acidic Residues

    • 15

    • Hydrophobic Residues

    • 32

    • Net Charge

    • 0

    • Boman Index

    • -140.76

    • Hydrophobicity

    • -0.267

    • Aliphatic Index

    • 101.72

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12950

    • Absorbance 280nm

    • 150.58

    • Polar Residues

    • 19

DRAMP02564

DRAMP02564 chydropathy plot

Comments Information

    • Function

    • CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Evidence for lateral gene transfer between Archaea and bacteria from genome sequence of Thermotoga maritima.

    • Reference

    • Nature. 1999 May 27;399(6734):323-329.

    • Author

    • Nelson KE, Clayton RA, Gill SR, Gwinn ML, Dodson RJ, Haft DH, Hickey EK, Peterson JD, Nelson WC, Ketchum KA, McDonald L, Utterback TR, Malek JA, Linher KD, Garrett MM, Stewart AM, Cotton MD, Pratt MS, Phillips CA, Richardson D, Heidelberg J, Sutton GG, Fleischmann RD, Eisen JA, White O, Salzberg SL, Smith HO, Venter JC, Fraser CM.