General Information

    • DRAMP ID

    • DRAMP02568

    • Peptide Name

    • Penaeidin 3-1

    • Source

    • Fenneropenaeus chinensis (Fleshy prawn) (Penaeus chinensis)

    • Family

    • Not found

    • Gene

    • PEN3-1

    • Sequence

    • KGGYTRPISRPPYGGGYGNVCTSCHVLTTSQARSCCSRFGRCCVPRRGYSG

    • Sequence Length

    • 51

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02568 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02568.

Physicochemical Information

    • Formula

    • C228H361N77O68S6

    • Absent Amino Acids

    • DEMW

    • Common Amino Acids

    • G

    • Mass

    • 5461.21

    • PI

    • 9.77

    • Basic Residues

    • 9

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +9

    • Boman Index

    • -115.18

    • Hydrophobicity

    • -0.547

    • Aliphatic Index

    • 34.31

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 6335

    • Absorbance 280nm

    • 126.7

    • Polar Residues

    • 30

DRAMP02568

DRAMP02568 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Molecular cloning and expression analysis of Ch-penaeidin, an antimicrobial peptide from Chinese shrimp, Fenneropenaeus chinensis.

    • Reference

    • Fish Shellfish Immunol. 2004 Apr;16(4):513-525.

    • Author

    • Kang CJ, Wang JX, Zhao XF, Yang XM, Shao HL, Xiang JH.