General Information

    • DRAMP ID

    • DRAMP02569

    • Peptide Name

    • Penaeidin

    • Source

    • Penaeus monodon (Giant tiger prawn)

    • Family

    • Not found

    • Gene

    • PEN3a

    • Sequence

    • MRLVVCLVFLASFALVCQAQGYQGGYTRPFPRPPYGGGYHPVPVCTSCHRLSPLQARACCRQLGRCCDAKQTYG

    • Sequence Length

    • 74

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02569 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02569.

Physicochemical Information

    • Formula

    • C357H556N106O94S9

    • Absent Amino Acids

    • EINW

    • Common Amino Acids

    • CGLPR

    • Mass

    • 8125.54

    • PI

    • 9.24

    • Basic Residues

    • 10

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 22

    • Net Charge

    • +9

    • Boman Index

    • -81.29

    • Hydrophobicity

    • 0.016

    • Aliphatic Index

    • 68.51

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7950

    • Absorbance 280nm

    • 108.9

    • Polar Residues

    • 27

DRAMP02569

DRAMP02569 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Cationic antimicrobial peptides in penaeid shrimp.

    • Reference

    • Mar Biotechnol (NY). 2010 Oct;12(5):487-505.

    • Author

    • Tassanakajon A, Amparyup P, Somboonwiwat K, Supungul P.