General Information

    • DRAMP ID

    • DRAMP02572

    • Peptide Name

    • Penaeidin-2b (Pen-2b; shrimps, Arthropods, animals)

    • Source

    • Litopenaeus vannamei (Whiteleg shrimp) (Penaeus vannamei)

    • Family

    • Belongs to the penaeidin family

    • Gene

    • Not found

    • Sequence

    • YRGGYTGPIPRPPPIGRPPLRPVCNACYRLSVSDARNCCIKFGSCCHLVK

    • Sequence Length

    • 50

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02572 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02572.

Physicochemical Information

    • Formula

    • C240H384N74O62S6

    • Absent Amino Acids

    • EMQW

    • Common Amino Acids

    • P

    • Mass

    • 5490.51

    • PI

    • 9.55

    • Basic Residues

    • 9

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +8

    • Boman Index

    • -79.85

    • Hydrophobicity

    • -0.228

    • Aliphatic Index

    • 68.2

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 98.88

    • Polar Residues

    • 20

DRAMP02572

DRAMP02572 chydropathy plot

Comments Information

    • Function

    • Antibacterial and antifungal activity. Presents chitin-binding activity.

    • Subcellular location

    • Cytoplasmic granule. Note

    • PTM

    • Contains three disulfide bonds 24-38; 27-45; 39-46 and lysine amide at K50.

Literature Information

  • ·Literature 1

    • Title

    • Diversity of the penaeidin antimicrobial peptides in two shrimp species.

    • Reference

    • Immunogenetics. 2002 Sep;54(6):442-445.

    • Author

    • Cuthbertson BJ, Shepard EF, Chapman RW, Gross PS.