• • DRAMP ID

  • DRAMP02573

• • Peptide Name

  • Penaeidin-3a (Pen-3a; shrimps, Arthropods, animals)

• • Source

  • Litopenaeus vannamei (Whiteleg shrimp) (Penaeus vannamei)

• • Family

  • Belongs to the penaeidin family

• • Gene

  • Not found

• • Sequence

  • QVYKGGYTRPIPRPPPFVRPLPGGPIGPYNGCPVSCRGISFSQARSCCSRLGRCCHVGKGYS

• • Sequence Length

  • 62

• • UniProt Entry

  • P81058

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

• • Target Organism

  • • Gram-positive bacteria: Aerococcus viridans (MIC=0.3-0.6 µM), Micrococcus luteus (MIC=1.25-2.5 µM), Bacillus megaterium (MIC=2.5-5 µM), Enterococcus fecalis (MIC>20 µM), Saphylococcus aureus (MIC>40 µM);
    • Gram-negative bacteria: Escherichia coli 363 (MI=10-20 µM), Vibrio vulnificus (MIC>20 µM), Salmonella thyphimurium (MIC>40 µM), Klebsiella pneumoniae (MIC>40 µM).
    • Fungi: Fusarium oxysporum (MIC=5-10 µM), Botrytis cinerea (MIC=5-10 µM), Neurospora crassa (MIC=1.25-2.5 µM), Aspergillus fumigatus (MIC>20 µM).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Chitin-binding

• • Linear/Cyclic

  • Cyclic

• • N-terminal Modification

  • pyroglutamic acid

• • C-terminal Modification

  • Amidation

• • Nonterminal Modifications and Unusual Amino Acids

  • Disulfide bonds between Cys32 and Cys47,Cys36 and Cys54,Cys48 and Cys55. O-glycosylated on Thr8

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP02573.

DRAMP02573

• • Function

  • Posesses antibacterial and antifungal activity. Presents chitin-binding activity.

• • Tissue specificity

  • Higher expression in hemocytes and to a lesser extent in heart, testis, gills, intestine, lymphonoid organ and hepatopancreas. Traces in eyes and subcuticular epithelium. Not present in the brain.

• • Developmental stage

  • Expression decreases 3 hours after microbial challenge to return to control levels after 12 hours and slightly increases after 24 hours.

• • PTM

  • C-terminal amidation and contains three disulfide bonds 32-47; 36-54; 48-55.

• ·Literature 1

• • Title

  • Penaeidins, a new family of antimicrobial peptides isolated from the shrimp Penaeus vannamei (Decapoda).

• • Pubmed ID

  • 9353298

• • Reference

  • J Biol Chem. 1997 Nov 7;272(45):28398-28406.

• • Author

  • Destoumieux D, Bulet P, Loew D, Van Dorsselaer A, Rodriguez J, Bachère E.

• ·Literature 2

• • Title

  • Recombinant expression and range of activity of penaeidins, antimicrobial peptides from penaeid shrimp.

• • Pubmed ID

  • 10561573

• • Reference

  • Eur J Biochem. 1999 Dec;266(2):335-346.

• • Author

  • Destoumieux D, Bulet P, Strub JM, Van Dorsselaer A, Bachère E.

• ·Literature 3

• • Title

  • Solution structure of the recombinant penaeidin-3, a shrimp antimicrobial peptide.

• • Pubmed ID

  • 12842879

• • Reference

  • J Biol Chem. 2003 Sep 19;278(38):36859-36867.

• • Author

  • Yang Y, Poncet J, Garnier J, Zatylny C, Bachère E, Aumelas A.