• DRAMP ID

    • DRAMP02576
    • Peptide Name

    • Penaeidin-3c (Pen-3c; shrimps, Arthropods, animals)
    • Source

    • Litopenaeus vannamei (Whiteleg shrimp) (Penaeus vannamei)
    • Family

    • Belongs to the penaeidin family
    • Gene

    • Not found
    • Sequence

    • QVYKGGYTRPIPRPPFVRPVPGGPIGPYNGCPVSCRGISFSQARSCCSRLGRCCHVGKGYS
    • Sequence Length

    • 61
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-positive bacterium: Micrococcus luteus;
      • Gram-negative bacterium: Escherichia coli.
      • Fungi: Neurospora crassa, Fusarium oxysporum.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Chitin-binding
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02576 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02576.
    • Formula

    • C285H447N89O76S6
    • Absent Amino Acids

    • DEMW
    • Common Amino Acids

    • GP
    • Mass

    • 6528.6
    • PI

    • 9.89
    • Basic Residues

    • 10
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 12
    • Net Charge

    • +10
    • Boman Index

    • -96.72
    • Hydrophobicity

    • -0.351
    • Aliphatic Index

    • 50.98
    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 6335
    • Absorbance 280nm

    • 105.58
    • Polar Residues

    • 28

DRAMP02576

DRAMP02576 chydropathy plot
    • Function

    • Posesses antibacterial and antifungal activity. Presents chitin-binding activity.
    • Subcellular location

    • Cytoplasmic granule. Note
    • Tissue specificity

    • Higher expression in hemocytes and to a lesser extent in heart, testis, gills, intestine, lymphonoid organ and hepatopancreas. Traces in eyes and subcuticular epithelium. Not present in the brain.
    • Developmental stage

    • Expression decreases 3 hours after microbial challenge to return to control levels after 12 hours and slightly increases after 24 hours.
    • PTM

    • Contains three disulfide bonds 31-46; 35-53; 47-54, Pyrrolidone carboxylic acid and Lysine amide at position 1 and 62 respectively.
  • ·Literature 1
    • Title

    • Penaeidins, a family of antimicrobial peptides from penaeid shrimp (Crustacea, Decapoda).
    • Reference

    • Cell Mol Life Sci. 2000 Aug;57(8-9):1260-1271.
    • Author

    • Destoumieux D, Munoz M, Bulet P, Bachère E.
  • ·Literature 2
    • Title

    • Penaeidins, antimicrobial peptides with chitin-binding activity, are produced and stored in shrimp granulocytes and released after microbial challenge.
    • Reference

    • J Cell Sci. 2000 Feb;113 (Pt 3):461-469.
    • Author

    • Destoumieux D, Muñoz M, Cosseau C, Rodriguez J, Bulet P, Comps M, Bachère E.