General Information

    • DRAMP ID

    • DRAMP02581

    • Peptide Name

    • Penaeidin-3h (Pen-3h; shrimps, Arthropods, animals)

    • Source

    • Litopenaeus vannamei (Whiteleg shrimp) (Penaeus vannamei)

    • Family

    • Belongs to the penaeidin family

    • Gene

    • Not found

    • Sequence

    • QVYKGGYTRPIPRPPPFVRPLPGGPIGPYNGCPISCRGISFSQARSYCSRLGRCCHVGKGYS

    • Sequence Length

    • 62

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02581 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02581.

Physicochemical Information

    • Formula

    • C298H462N90O78S5

    • Absent Amino Acids

    • DEMW

    • Common Amino Acids

    • GP

    • Mass

    • 6713.8

    • PI

    • 9.98

    • Basic Residues

    • 10

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +10

    • Boman Index

    • -96.38

    • Hydrophobicity

    • -0.434

    • Aliphatic Index

    • 53.39

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7700

    • Absorbance 280nm

    • 126.23

    • Polar Residues

    • 28

DRAMP02581

DRAMP02581 chydropathy plot

Comments Information

    • Function

    • Posesses antibacterial and antifungal activity. Presents chitin-binding activity.

    • Subcellular location

    • Cytoplasmic granule. Note

    • PTM

    • Contains two disulfide bonds 36-54; 48-55, Pyrrolidone carboxylic acid and Serine amide at position 1 and 62 respectively.

Literature Information

  • ·Literature 1

    • Title

    • Diversity of the penaeidin antimicrobial peptides in two shrimp species.

    • Reference

    • Immunogenetics. 2002 Sep;54(6):442-445.

    • Author

    • Cuthbertson BJ, Shepard EF, Chapman RW, Gross PS.