General Information

    • DRAMP ID

    • DRAMP02584

    • Peptide Name

    • Penaeidin-4a (Pen-4a; shrimps, Arthropods, animals)

    • Source

    • Litopenaeus vannamei (Whiteleg shrimp) (Penaeus vannamei)

    • Family

    • Belongs to the penaeidin family

    • Gene

    • Not found

    • Sequence

    • HSSGYTRPLPKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCHR

    • Sequence Length

    • 47

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-positive bacteria: Aerococcus viridans (MIC=1.9-2.92 µM), Micrococcus luteus (MIC=1.9-2.92 µM), Bacillus megaterium (MIC>50 µM), Saphylococcus aureus (MIC>50 µM);
      • Gram-negative bacteria: Escherichia coli 363 (MIC=22-33 µM), Vibrio vulnificus (MIC>50 µM), Salmonella thyphimurium (MIC>50 µM), Klebsiella pneumoniae (MIC>50 µM).
      • Fungi: Fusarium oxysporum (MIC=0.84-1.26 µM), Botrytis cinerea (MIC=4.38-6.57 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Amidation

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys23 and Cys37,Cys26 and Cys44,Cys38 and Cys45.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02584 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02584.

Physicochemical Information

    • Formula

    • C230H358N70O62S6

    • Absent Amino Acids

    • EMNQW

    • Common Amino Acids

    • CPR

    • Mass

    • 5288.16

    • PI

    • 9.15

    • Basic Residues

    • 9

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +7

    • Boman Index

    • -91.62

    • Hydrophobicity

    • -0.268

    • Aliphatic Index

    • 58.09

    • Half Life

      • Mammalian:3.5 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 105.33

    • Polar Residues

    • 20

DRAMP02584

DRAMP02584 chydropathy plot

Comments Information

    • Function

    • Posesses antibacterial and antifungal activity. Presents chitin-binding activity (By similarity).

    • PTM

    • Contains three disulfide bonds 23-37; 26-44; 38-45 and C-terminal amidation.

Literature Information

  • ·Literature 1

    • Title

    • Diversity of the penaeidin antimicrobial peptides in two shrimp species.

    • Reference

    • Immunogenetics. 2002 Sep;54(6):442-445.

    • Author

    • Cuthbertson BJ, Shepard EF, Chapman RW, Gross PS.
  • ·Literature 2

    • Title

    • A new class (penaeidin class 4) of antimicrobial peptides from the Atlantic white shrimp (Litopenaeus setiferus) exhibits target specificity and an independent proline-rich-domain function.

    • Reference

    • Biochem J. 2004 Jul 1;381(Pt 1):79-86.

    • Author

    • Cuthbertson BJ, Bullesbach EE, Fievet J, Bachère E, Gross PS.