General Information

    • DRAMP ID

    • DRAMP02585

    • Peptide Name

    • Penaeidin-4c (Pen-4c; shrimps, Arthropods, animals)

    • Source

    • Litopenaeus vannamei (Whiteleg shrimp) (Penaeus vannamei)

    • Family

    • Belongs to the penaeidin family

    • Gene

    • Not found

    • Sequence

    • YSSGYTRPLPKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCHR

    • Sequence Length

    • 47

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02585 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02585.

Physicochemical Information

    • Formula

    • C233H360N68O63S6

    • Absent Amino Acids

    • EMNQW

    • Common Amino Acids

    • CPR

    • Mass

    • 5314.2

    • PI

    • 9.12

    • Basic Residues

    • 8

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +6

    • Boman Index

    • -87.1

    • Hydrophobicity

    • -0.228

    • Aliphatic Index

    • 58.09

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 6335

    • Absorbance 280nm

    • 137.72

    • Polar Residues

    • 21

DRAMP02585

DRAMP02585 chydropathy plot

Comments Information

    • Function

    • Posesses antibacterial and antifungal activity. Presents chitin-binding activity (By similarity).

    • PTM

    • Contains three disulfide bonds 23-37; 26-44; 38-45 and C-terminal amidation.

Literature Information

  • ·Literature 1

    • Title

    • Diversity of the penaeidin antimicrobial peptides in two shrimp species.

    • Reference

    • Immunogenetics. 2002 Sep;54(6):442-445.

    • Author

    • Cuthbertson BJ, Shepard EF, Chapman RW, Gross PS.