General Information

    • DRAMP ID

    • DRAMP02586

    • Peptide Name

    • Penaeidin-2d (Pen-2d; shrimps, Arthropods, animals)

    • Source

    • Litopenaeus setiferus (Atlantic white shrimp) (Penaeus setiferus)

    • Family

    • Belongs to the penaeidin family

    • Gene

    • Not found

    • Sequence

    • QRGGFTGPIPRPPPHGRPPLGPICNACYRLSFSDVRICCNFLGKCCHLVK

    • Sequence Length

    • 50

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-positive bacteria: Aerococcus viridans (MIC=1.25-2.5 µM), Micrococcus luteus (MIC=2.5-5 µM), Bacillus megaterium (MIC=2.5-5 µM), Enterococcus fecalis (MIC>20 µM), Saphylococcus aureus (MIC>20 µM);
      • Gram-negative bacteria: Escherichia coli 363 (MIC>40 µM), Vibrio vulnificus (MIC>20 µM), Salmonella thyphimurium (MIC>20 µM), Klebsiella pneumoniae (MIC>20 µM).
      • Fungi: Fusarium oxysporum (MIC=5-10 µM), Botrytis cinerea (MIC=5-10 µM), Neurospora crassa (MIC=2.5-5 µM), Aspergillus fumigatus (MIC>20 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02586 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02586.

Physicochemical Information

    • Formula

    • C242H382N74O60S6

    • Absent Amino Acids

    • EMW

    • Common Amino Acids

    • P

    • Mass

    • 5480.51

    • PI

    • 9.43

    • Basic Residues

    • 9

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +8

    • Boman Index

    • -65.48

    • Hydrophobicity

    • -0.144

    • Aliphatic Index

    • 68.2

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 38.06

    • Polar Residues

    • 18

DRAMP02586

DRAMP02586 chydropathy plot

Comments Information

    • Function

    • Antibacterial and antifungal activity. Presents chitin-binding activity (By similarity).

    • Subcellular location

    • Cytoplasmic granule. Note

Literature Information

  • ·Literature 1

    • Title

    • Diversity of the penaeidin antimicrobial peptides in two shrimp species.

    • Reference

    • Immunogenetics. 2002 Sep;54(6):442-445.

    • Author

    • Cuthbertson BJ, Shepard EF, Chapman RW, Gross PS.
  • ·Literature 2

    • Title

    • Recombinant expression and range of activity of penaeidins, antimicrobial peptides from penaeid shrimp.

    • Reference

    • Eur J Biochem. 1999 Dec;266(2):335-346.

    • Author

    • Destoumieux D, Bulet P, Strub JM, Van Dorsselaer A, Bachère E.