General Information

    • DRAMP ID

    • DRAMP02589

    • Peptide Name

    • Penaeidin-3m (Pen-3m; shrimps, Arthropods, animals)

    • Source

    • Litopenaeus setiferus (Atlantic white shrimp) (Penaeus setiferus)

    • Family

    • Belongs to the penaeidin family

    • Gene

    • Not found

    • Sequence

    • QGCKGPYTRPILRPYVRPVVSYNACTLSCRGITTTQARSCCTRLGRCCHVAKGYS

    • Sequence Length

    • 55

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02589 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02589.

Physicochemical Information

    • Formula

    • C256H421N83O73S7

    • Absent Amino Acids

    • DEFMW

    • Common Amino Acids

    • CRT

    • Mass

    • 6054.09

    • PI

    • 9.72

    • Basic Residues

    • 10

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +10

    • Boman Index

    • -107.65

    • Hydrophobicity

    • -0.253

    • Aliphatic Index

    • 62

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6335

    • Absorbance 280nm

    • 117.31

    • Polar Residues

    • 27

DRAMP02589

DRAMP02589 chydropathy plot

Comments Information

    • Function

    • Posesses antibacterial and antifungal activity. Presents chitin-binding activity.

    • Subcellular location

    • Cytoplasmic granule. Note

    • PTM

    • Contains three disulfide bonds 25-40; 29-47; 41-48, Pyrrolidone carboxylic acid and Serine amide at position 1 and 55 respectively.

Literature Information

  • ·Literature 1

    • Title

    • Diversity of the penaeidin antimicrobial peptides in two shrimp species.

    • Reference

    • Immunogenetics. 2002 Sep;54(6):442-445.

    • Author

    • Cuthbertson BJ, Shepard EF, Chapman RW, Gross PS.