General Information

    • DRAMP ID

    • DRAMP02591

    • Peptide Name

    • Penaeidin-4d (Pen-4d; shrimps, Arthropods, animals)

    • Source

    • Litopenaeus setiferus (Atlantic white shrimp) (Penaeus setiferus)

    • Family

    • Belongs to the penaeidin family

    • Gene

    • Not found

    • Sequence

    • HSSGYTRPLRKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCHL

    • Sequence Length

    • 47

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal

    • Target Organism

      • Fungi: Fusarium oxysporum (MIC=0.84-1.26 µM), Botrytis cinerea (MIC=4.38-6.57 µM), Penicillium crustosum (MIC=1.26-1.9 µM).
      • Gram-positive bacteria: Aerococcus viridans (MIC=1.9-2.92 µM), Bacillus megaterium (MIC>50 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Alpha helix (1 helices; 9 residues)

    • Structure Description

    • Calculation of PEN4 three-dimensional structure reveales that the PEN4 structure consisted of an unconstrained and a constrained part, which roughly match with the PRD (residues 1-17) and the CRD (residues 18-47), respectively. The global fold of the CRD mainly consisted of a helix (residues 31-41), two turns of type IV (Cys23-Cys26 and Gly42-Cys45 residues), and one loop spanning 27-30 residues (Ref.2).

    • Helical Wheel Diagram

    • DRAMP02591 helical wheel diagram

    • PDB ID

    • 1XV3 resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP02591.

Physicochemical Information

    • Formula

    • C231H362N70O62S6

    • Absent Amino Acids

    • EMNQW

    • Common Amino Acids

    • CR

    • Mass

    • 5304.21

    • PI

    • 9.15

    • Basic Residues

    • 9

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +7

    • Boman Index

    • -86.7

    • Hydrophobicity

    • -0.153

    • Aliphatic Index

    • 66.38

    • Half Life

      • Mammalian:3.5 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 105.33

    • Polar Residues

    • 20

DRAMP02591

DRAMP02591 chydropathy plot

Comments Information

    • Function

    • Posesses antibacterial and antifungal activity. Presents chitin-binding activity (By similarity).

    • PTM

    • Contains three disulfide bonds 23-37; 26-44; 38-45.

Literature Information

  • ·Literature 1

    • Title

    • Diversity of the penaeidin antimicrobial peptides in two shrimp species.

    • Reference

    • Immunogenetics. 2002 Sep;54(6):442-445.

    • Author

    • Cuthbertson BJ, Shepard EF, Chapman RW, Gross PS.
  • ·Literature 2

    • Title

    • Solution structure of synthetic penaeidin-4 with structural and functional comparisons with penaeidin-3.

    • Reference

    • J Biol Chem. 2005 Apr 22;280(16):16009-18.

    • Author

    • Cuthbertson BJ, Yang Y, Bachère E, Büllesbach EE, Gross PS, Aumelas A.