• DRAMP ID

    • DRAMP02595
    • Peptide Name

    • Styelin-D (Styelin D; chordates)
    • Source

    • Styela clava (Sea squirt)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • GWLRKAAKSVGKFYYKHKYYIKAAWQIGKHAL
    • Sequence Length

    • 32
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02595 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02595.
    • Formula

    • C185H277N49O39
    • Absent Amino Acids

    • CDEMNPT
    • Common Amino Acids

    • K
    • Mass

    • 3811.54
    • PI

    • 10.24
    • Basic Residues

    • 10
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 13
    • Net Charge

    • +10
    • Boman Index

    • -29.36
    • Hydrophobicity

    • -0.566
    • Aliphatic Index

    • 73.44
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 16960
    • Absorbance 280nm

    • 547.1
    • Polar Residues

    • 8

DRAMP02595

DRAMP02595 chydropathy plot
    • Function

    • Bactericidal against several Gram-positive and Gram- negative bacteria.PTM
  • ·Literature 1
    • Title

    • cDNA cloning of three cecropin-like antimicrobial peptides (Styelins)from the tunicate, Styela clava.
    • Reference

    • FEBS Lett. 412:144-148(1997).
    • Author

    • Zhao C., Liaw L., Lee I.H., Lehrer R.I.
  • ·Literature 2
    • Title

    • Styelin D, an extensively modified antimicrobial peptide fromascidian hemocytes.
    • Reference

    • J. Biol. Chem. 275:38417-38426(2000).
    • Author

    • Taylor S.W., Craig A.G., Fischer W.H., Park M., Lehrer R.I.