General Information

    • DRAMP ID

    • DRAMP02596

    • Peptide Name

    • Styelin-E (Styelin E; chordates, animals)

    • Source

    • Styela clava (Sea squirt)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GWLRKAAKSVGKFYYKHKYYIKAAWKIGRHAL

    • Sequence Length

    • 32

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02596 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02596.

Physicochemical Information

    • Formula

    • C186H281N51O38

    • Absent Amino Acids

    • CDEMNPQT

    • Common Amino Acids

    • K

    • Mass

    • 3839.6

    • PI

    • 10.42

    • Basic Residues

    • 11

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +11

    • Boman Index

    • -38.74

    • Hydrophobicity

    • -0.597

    • Aliphatic Index

    • 73.44

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 16960

    • Absorbance 280nm

    • 547.1

    • Polar Residues

    • 8

DRAMP02596

DRAMP02596 chydropathy plot

Comments Information

    • Function

    • Bactericidal against several Gram-positive and Gram- negative bacteria (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • cDNA cloning of three cecropin-like antimicrobial peptides (Styelins) from the tunicate, Styela clava.

    • Reference

    • FEBS Lett. 1997 Jul 21;412(1):144-148.

    • Author

    • Zhao C, Liaw L, Lee IH, Lehrer RI.