General Information

    • DRAMP ID

    • DRAMP02609

    • Peptide Name

    • CjaRL-37 (cathelicidin; primates, mammals, animals)

    • Source

    • Platyrrhini (New World monkeys)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • RLGDILQKAREKIEGGLKKLVQKIKDFFGKFAPRTES

    • Sequence Length

    • 37

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

      • In 20% TSB in SPB medium: Escherichia coli (MIC=4 µM), Pseudomonas aeruginosa (MIC>32 µM); Staphylococcus aureus (MIC=32 µM), Enterococcus faecalis (MIC>32 µM).
      • In 20% SAB in SPB medium: Candida albicans (MIC>32 µM). In 5% SAB in SPB Candida albicans (MIC>32 µM). In 20% SAB in PIL Candida albicans (MIC>32 µM).
      • In 5% TSB in SPB Escherichia coli (MIC=1 µM), Pseudomonas aeruginosa (MIC=2 µM), Staphylococcus aureus (MIC=8-16 µM).
      • In 20% TSB in PIL Escherichia coli (MIC>32 µM), Pseudomonas aeruginosa (MIC>32 µM); Staphylococcus aureus (MIC=16 µM), Enterococcus faecalis (MIC>32 µM).
      • In 50% MH in SPB medium Escherichia coli (MIC>32 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02609 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02609.

Physicochemical Information

    • Formula

    • C193H323N55O52

    • Absent Amino Acids

    • CHMNWY

    • Common Amino Acids

    • K

    • Mass

    • 4246.02

    • PI

    • 10.12

    • Basic Residues

    • 10

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +5

    • Boman Index

    • -83.73

    • Hydrophobicity

    • -0.678

    • Aliphatic Index

    • 87.03

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 6

DRAMP02609

DRAMP02609 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity.

Literature Information

  • ·Literature 1

    • Title

    • Evolution of the primate cathelicidin. Correlation between structural variations and antimicrobial activity.

    • Reference

    • J Biol Chem. 2006 Jul 21;281(29):19861-19871.

    • Author

    • Zelezetsky I, Pontillo A, Puzzi L, Antcheva N, Segat L, Pacor S, Crovella S, Tossi A.