General Information

    • DRAMP ID

    • DRAMP02614

    • Peptide Name

    • Beta-defensin 105A (Defensin, beta 105; Defensin, beta 105A; primates, mammals, animals)

    • Source

    • Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB105A

    • Sequence

    • GLEFSEPFPSGRFAVCESCKLGRGKCRKECLENEKPDGSCRLNFLCCRPRM

    • Sequence Length

    • 51

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02614 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02614.

Physicochemical Information

    • Formula

    • C244H393N75O72S8

    • Absent Amino Acids

    • HIQTWY

    • Common Amino Acids

    • CER

    • Mass

    • 5785.74

    • PI

    • 8.58

    • Basic Residues

    • 10

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +3

    • Boman Index

    • -129.8

    • Hydrophobicity

    • -0.59

    • Aliphatic Index

    • 45.88

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 7.5

    • Polar Residues

    • 18

DRAMP02614

DRAMP02614 chydropathy plot

Comments Information

    • Function

    • Has antimicrobial activity (By similarity).

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Evolution and sequence variation of human beta-defensin genes.

    • Reference

    • Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases

    • Author

    • Hollox E.J, Armour J.A.L.