General Information

    • DRAMP ID

    • DRAMP02615

    • Peptide Name

    • Beta-defensin 1 (BD-1; Defensin, beta 1; primates, mammals, animals)

    • Source

    • Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB1

    • Sequence

    • DHYNCVRSGGQCLYSACPIYTRIQGTCYHGKAKCCK

    • Sequence Length

    • 36

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02615 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02615.

Physicochemical Information

    • Formula

    • C170H264N52O50S6

    • Absent Amino Acids

    • EFMW

    • Common Amino Acids

    • C

    • Mass

    • 4028.64

    • PI

    • 8.87

    • Basic Residues

    • 7

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +6

    • Boman Index

    • -60.89

    • Hydrophobicity

    • -0.469

    • Aliphatic Index

    • 46.11

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6335

    • Absorbance 280nm

    • 181

    • Polar Residues

    • 19

DRAMP02615

DRAMP02615 chydropathy plot

Comments Information

    • Function

    • Has bactericidal activity (By similarity).

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Small cationic protein from a marine turtle has beta-defensin-like fold and antibacterial and antiviral activity.

    • Reference

    • Proteins. 2006 Aug 1;64(2):524-531.

    • Author

    • Chattopadhyay S, Sinha NK, Banerjee S, Roy D, Chattopadhyay D, Roy S.