• DRAMP ID

    • DRAMP02615
    • Peptide Name

    • Beta-defensin 1 (BD-1; Defensin, beta 1; primates, mammals, animals)
    • Source

    • Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • DEFB1
    • Sequence

    • DHYNCVRSGGQCLYSACPIYTRIQGTCYHGKAKCCK
    • Sequence Length

    • 36
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02615 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02615.
    • Formula

    • C170H264N52O50S6
    • Absent Amino Acids

    • EFMW
    • Common Amino Acids

    • C
    • Mass

    • 4028.64
    • PI

    • 8.87
    • Basic Residues

    • 7
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 6
    • Net Charge

    • +6
    • Boman Index

    • -60.89
    • Hydrophobicity

    • -0.469
    • Aliphatic Index

    • 46.11
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 6335
    • Absorbance 280nm

    • 181
    • Polar Residues

    • 19

DRAMP02615

DRAMP02615 chydropathy plot
    • Function

    • Has bactericidal activity (By similarity).
    • PTM

    • Contains three disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • Small cationic protein from a marine turtle has beta-defensin-like fold and antibacterial and antiviral activity.
    • Reference

    • Proteins. 2006 Aug 1;64(2):524-531.
    • Author

    • Chattopadhyay S, Sinha NK, Banerjee S, Roy D, Chattopadhyay D, Roy S.