General Information

    • DRAMP ID

    • DRAMP02616

    • Peptide Name

    • Beta-defensin 126 (Defensin, beta 126; Epididymal secretory protein 13.2, ESP13.2; primates, mamm

    • Source

    • Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB126

    • Sequence

    • NLYVKRCLNDIGICKKTCKPEEVRSEHGWVMCGKRKACCVPAD

    • Sequence Length

    • 43

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02616 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02616.

Physicochemical Information

    • Formula

    • C207H343N63O59S7

    • Absent Amino Acids

    • FQ

    • Common Amino Acids

    • CK

    • Mass

    • 4882.81

    • PI

    • 8.87

    • Basic Residues

    • 10

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +5

    • Boman Index

    • -85.34

    • Hydrophobicity

    • -0.437

    • Aliphatic Index

    • 67.91

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 175.36

    • Polar Residues

    • 14

DRAMP02616

DRAMP02616 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity (Potential).

    • Tissue specificity

    • High-level and epididymis-specific expression. Detected in epithelial cells lining the efferent ductules, initial segment, and cauda regions of the epididymis, but not on spermatozoa.

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • The novel epididymal secretory protein ESP13.2 in Macaca fascicularis.

    • Reference

    • Biol Reprod. 1999 Oct;61(4):965-972.

    • Author

    • Perry AC, Jones R, Moisyadi S, Coadwell J, Hall L.