General Information

    • DRAMP ID

    • DRAMP02618

    • Peptide Name

    • Beta-defensin 118 (Defensin, beta 118; primates, mammals, animals)

    • Source

    • Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB118

    • Sequence

    • AYGGEKKCWNRSGHCRKQCKDGEAVKETCKNHRACCVPSNEDH

    • Sequence Length

    • 43

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02618 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02618.

Physicochemical Information

    • Formula

    • C197H313N69O64S6

    • Absent Amino Acids

    • FILM

    • Common Amino Acids

    • CK

    • Mass

    • 4864.44

    • PI

    • 8.63

    • Basic Residues

    • 12

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +6

    • Boman Index

    • -144.41

    • Hydrophobicity

    • -1.405

    • Aliphatic Index

    • 20.47

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 175.36

    • Polar Residues

    • 17

DRAMP02618

DRAMP02618 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity (Potential).

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Evolution and sequence variation of human beta-defensin genes.

    • Reference

    • Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases

    • Author

    • Hollox EJ, Armour JAL.