• DRAMP ID

    • DRAMP02621
    • Peptide Name

    • Beta-defensin 132 (Defensin, beta 132; primates, mammals, animals)
    • Source

    • Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • DEFB132
    • Sequence

    • GGSKCVSDTPGYCRTHCHRGETALFMCSPFRKCCISYSFLPQPDLPQLIGNHWPSRSRNTQRKNKKQQTTVTP
    • Sequence Length

    • 73
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02621 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02621.
    • Formula

    • C356H561N111O104S7
    • Absent Amino Acids

    • ?
    • Common Amino Acids

    • PSTCR
    • Mass

    • 8284.47
    • PI

    • 9.64
    • Basic Residues

    • 14
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 13
    • Net Charge

    • +11
    • Boman Index

    • -179.78
    • Hydrophobicity

    • -0.851
    • Aliphatic Index

    • 41.37
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8855
    • Absorbance 280nm

    • 122.99
    • Polar Residues

    • 30

DRAMP02621

DRAMP02621 chydropathy plot
    • Function

    • Has antibacterial activity (Potential).
    • PTM

    • Contains three disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • Evolution and sequence variation of human beta-defensin genes.
    • Reference

    • Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases
    • Author

    • Hollox EJ, Armour JAL.