General Information

    • DRAMP ID

    • DRAMP02630

    • Peptide Name

    • Rhesus monkey beta-defensin 2 (RhBD-2; Defensin, beta 2; primates, mammals, animals)

    • Source

    • Macaca mulatta (Rhesus macaque)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB4A

    • Sequence

    • GIGDPVTCLKNGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

    • Sequence Length

    • 41

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02630 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02630.

Physicochemical Information

    • Formula

    • C189H312N56O50S6

    • Absent Amino Acids

    • EMSW

    • Common Amino Acids

    • CG

    • Mass

    • 4361.26

    • PI

    • 9.3

    • Basic Residues

    • 8

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +7

    • Boman Index

    • -40.21

    • Hydrophobicity

    • -0.168

    • Aliphatic Index

    • 64.15

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 46.63

    • Polar Residues

    • 17

DRAMP02630

DRAMP02630 chydropathy plot

Comments Information

    • Function

    • Has bactericidal activity (By similarity).

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Rhesus monkey (Macaca mulatta) mucosal antimicrobial peptides are close homologues of human molecules.

    • Reference

    • Clin Diagn Lab Immunol. 2001 Mar;8(2):370-375.

    • Author

    • Bals R, Lang C, Weiner DJ, Vogelmeier C, Welsch U, Wilson JM.