General Information

    • DRAMP ID

    • DRAMP02633

    • Peptide Name

    • Beta-defensin 122 (Defensin, beta 122; primates, mammals, animals)

    • Source

    • Macaca mulatta (Rhesus macaque)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB122

    • Sequence

    • VGSIEKCWNFRGSCRDECLKNEKVYVFCMSGKLCCLKPKDQPHLPQRTKN

    • Sequence Length

    • 50

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02633 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02633.

Physicochemical Information

    • Formula

    • C251H404N74O71S7

    • Absent Amino Acids

    • A

    • Common Amino Acids

    • KC

    • Mass

    • 5818.84

    • PI

    • 9.06

    • Basic Residues

    • 11

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +6

    • Boman Index

    • -112.19

    • Hydrophobicity

    • -0.71

    • Aliphatic Index

    • 56.4

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 150.31

    • Polar Residues

    • 17

DRAMP02633

DRAMP02633 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity (Potential).

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Differential expression of a primate beta defensin gene cluster specific to male reproductive tract.

    • Reference

    • Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases

    • Author

    • Yashwanth R, Hamil K.G, Yenugu S, French F.S, Hall S.H.