General Information

    • DRAMP ID

    • DRAMP02635

    • Peptide Name

    • Beta-defensin 119 (Defensin, beta 119; Beta-defensin 120; Defensin, beta 120; primates, mammals,

    • Source

    • Macaca mulatta (Rhesus macaque)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB119

    • Sequence

    • KRHILRCMGNSGICRASCKKNEQPYLYCRNYQACCLQSYMRISISGKEENTDWSYEKQWPRLP

    • Sequence Length

    • 63

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02635 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02635.

Physicochemical Information

    • Formula

    • C324H508N98O94S8

    • Absent Amino Acids

    • FV

    • Common Amino Acids

    • CRSKY

    • Mass

    • 7536.68

    • PI

    • 9.19

    • Basic Residues

    • 12

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +7

    • Boman Index

    • -167.44

    • Hydrophobicity

    • -0.943

    • Aliphatic Index

    • 52.7

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 18825

    • Absorbance 280nm

    • 303.63

    • Polar Residues

    • 25

DRAMP02635

DRAMP02635 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity (Potential).

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Differential expression of a primate beta defensin gene cluster specific to male reproductive tract.

    • Reference

    • Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases.

    • Author

    • Yashwanth R, Hamil K.G, Yenugu S, French F.S, Hall S.H.