General Information

    • DRAMP ID

    • DRAMP02647

    • Peptide Name

    • Beta-defensin 2

    • Source

    • Macaca mulatta (Rhesus monkey)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • DPVTCLKNGAICHPVFCPRRYKQIGTCGLPGTKCCK

    • Sequence Length

    • 36

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02647 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02647.

Physicochemical Information

    • Formula

    • C168H276N50O45S6

    • Absent Amino Acids

    • EMSW

    • Common Amino Acids

    • C

    • Mass

    • 3908.71

    • PI

    • 9.13

    • Basic Residues

    • 7

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +6

    • Boman Index

    • -41.46

    • Hydrophobicity

    • -0.142

    • Aliphatic Index

    • 62.22

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 53.29

    • Polar Residues

    • 15

DRAMP02647

DRAMP02647 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Not found

    • Reference

    • Not found

    • Author

    • Not found