General Information

    • DRAMP ID

    • DRAMP02650

    • Peptide Name

    • Sperm associated antigen 11 isoform C (primates, mammals, animals)

    • Source

    • Macaca mulatta (Rhesus monkey)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • APIIRRIPYYPEVESDLRIVDCKRSEGFCQEYCNYLETQVGYCSKKKDACCLH

    • Sequence Length

    • 53

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli (MIC=50-100 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02650 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02650.

Physicochemical Information

    • Formula

    • C272H424N74O82S6

    • Absent Amino Acids

    • MW

    • Common Amino Acids

    • CEY

    • Mass

    • 6235.17

    • PI

    • 6.77

    • Basic Residues

    • 9

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +1

    • Boman Index

    • -115.22

    • Hydrophobicity

    • -0.511

    • Aliphatic Index

    • 71.7

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7825

    • Absorbance 280nm

    • 150.48

    • Polar Residues

    • 18

DRAMP02650

DRAMP02650 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Differential expression and antibacterial activity of epididymis protein 2 isoforms in the male reproductive tract of human and rhesus monkey (Macaca mulatta).

    • Reference

    • Biol Reprod. 2004 Nov;71(5):1453-1460.

    • Author

    • Avellar MC, Honda L, Hamil KG, Yenugu S, Grossman G, Petrusz P, French FS, Hall SH.