• DRAMP ID

    • DRAMP02651
    • Peptide Name

    • Sperm associated antigen 11 isoform E (primates, mammals, animals)
    • Source

    • Macaca mulatta (Rhesus monkey)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • GDVPPGIRNTICLMQQGTCRLFFCHSGEKKRDICSDPWNRCCVSNRDEEGKEKPKTDGRSGI
    • Sequence Length

    • 62
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02651 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02651.
    • Formula

    • C290H469N93O93S7
    • Absent Amino Acids

    • AY
    • Common Amino Acids

    • GCR
    • Mass

    • 6970.9
    • PI

    • 8.32
    • Basic Residues

    • 12
    • Acidic Residues

    • 9
    • Hydrophobic Residues

    • 11
    • Net Charge

    • +3
    • Boman Index

    • -182.58
    • Hydrophobicity

    • -0.929
    • Aliphatic Index

    • 47.1
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5875
    • Absorbance 280nm

    • 96.31
    • Polar Residues

    • 23

DRAMP02651

DRAMP02651 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Differential expression and antibacterial activity of epididymis protein 2 isoforms in the male reproductive tract of human and rhesus monkey (Macaca mulatta).
    • Reference

    • Biol Reprod. 2004 Nov;71(5):1453-1460.
    • Author

    • Avellar MC, Honda L, Hamil KG, Yenugu S, Grossman G, Petrusz P, French FS, Hall SH.