General Information

    • DRAMP ID

    • DRAMP02651

    • Peptide Name

    • Sperm associated antigen 11 isoform E (primates, mammals, animals)

    • Source

    • Macaca mulatta (Rhesus monkey)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GDVPPGIRNTICLMQQGTCRLFFCHSGEKKRDICSDPWNRCCVSNRDEEGKEKPKTDGRSGI

    • Sequence Length

    • 62

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02651 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02651.

Physicochemical Information

    • Formula

    • C290H469N93O93S7

    • Absent Amino Acids

    • AY

    • Common Amino Acids

    • GCR

    • Mass

    • 6970.9

    • PI

    • 8.32

    • Basic Residues

    • 12

    • Acidic Residues

    • 9

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +3

    • Boman Index

    • -182.58

    • Hydrophobicity

    • -0.929

    • Aliphatic Index

    • 47.1

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 96.31

    • Polar Residues

    • 23

DRAMP02651

DRAMP02651 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Differential expression and antibacterial activity of epididymis protein 2 isoforms in the male reproductive tract of human and rhesus monkey (Macaca mulatta).

    • Reference

    • Biol Reprod. 2004 Nov;71(5):1453-1460.

    • Author

    • Avellar MC, Honda L, Hamil KG, Yenugu S, Grossman G, Petrusz P, French FS, Hall SH.