• DRAMP ID

    • DRAMP02655
    • Peptide Name

    • Alpha defensin (primates, mammals, animals)
    • Source

    • Macaca mulatta (Rhesus macaque)
    • Family

    • Not found
    • Gene

    • DEFA1
    • Sequence

    • MRTFALLTAVLLVALQAQAGPLQARCDEAAGQEQPGVDDQDISISFAWDKISALQASGERGQYEEPQSLQGWMGDRLWNRVSMVHVT
    • Sequence Length

    • 87
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02655 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02655.
    • Formula

    • C417H655N119O131S4
    • Absent Amino Acids

    • ?
    • Common Amino Acids

    • AQ
    • Mass

    • 9559.75
    • PI

    • 4.5
    • Basic Residues

    • 7
    • Acidic Residues

    • 11
    • Hydrophobic Residues

    • 34
    • Net Charge

    • -4
    • Boman Index

    • -130.42
    • Hydrophobicity

    • -0.214
    • Aliphatic Index

    • 86.44
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 17990
    • Absorbance 280nm

    • 209.19
    • Polar Residues

    • 19

DRAMP02655

DRAMP02655 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Evolution of primate theta-defensins: a serpentine path to a sweet tooth.
    • Reference

    • ptides. 2003 Nov;24(11):1647-1654.
    • Author

    • Nguyen TX, Cole AM, Lehrer RI.