General Information

    • DRAMP ID

    • DRAMP02658

    • Peptide Name

    • Alpha-defensin 6 (primates, mammals, animals)

    • Source

    • Macaca mulatta (Rhesus macaque)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MRTLTILAAILLFALLAQAKSLQETADDAATQEQPGEDDQDLAVSFEENGLSTLRASGSQARRNCHCRIGHCRRPAAPMGVCIIHGQFGKLCCR

    • Sequence Length

    • 94

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02658 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02658.

Physicochemical Information

    • Formula

    • C430H707N135O134S8

    • Absent Amino Acids

    • WY

    • Common Amino Acids

    • A

    • Mass

    • 10168.65

    • PI

    • 6.8

    • Basic Residues

    • 13

    • Acidic Residues

    • 10

    • Hydrophobic Residues

    • 34

    • Net Charge

    • +3

    • Boman Index

    • -165.77

    • Hydrophobicity

    • -0.125

    • Aliphatic Index

    • 86.38

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 4.03

    • Polar Residues

    • 25

DRAMP02658

DRAMP02658 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Paneth cell alpha-defensins from rhesus macaque small intestine.

    • Reference

    • Infect Immun. 2004 Mar;72(3):1470-1478.

    • Author

    • Tanabe H, Yuan J, Zaragoza MM, Dandekar S, Henschen-Edman A, Selsted ME, Ouellette AJ.