General Information

    • DRAMP ID

    • DRAMP02659

    • Peptide Name

    • Neutrophil defensin 3 (RMAD-3; primates, mammals, animals)

    • Source

    • Macaca mulatta (Rhesus monkey)

    • Family

    • Belongs to the alpha-defensin family

    • Gene

    • Not found

    • Sequence

    • ACYCRIPACLAGERRYGTCFYRRRVWAFCC

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacteria: Staphylococcus aureus and Listeria monocytogenes;
      • Gram-negative bacteria: Escherichia coli.
      • Fungi: Cryptococcus neoformans.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02659 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02659.

Physicochemical Information

    • Formula

    • C157H237N49O37S6

    • Absent Amino Acids

    • DHKMNQS

    • Common Amino Acids

    • CR

    • Mass

    • 3595.28

    • PI

    • 9.18

    • Basic Residues

    • 6

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +5

    • Boman Index

    • -60.35

    • Hydrophobicity

    • 0.063

    • Aliphatic Index

    • 49

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 10345

    • Absorbance 280nm

    • 356.72

    • Polar Residues

    • 12

DRAMP02659

DRAMP02659 chydropathy plot

Comments Information

    • Function

    • Has bacteriostatic and antifungal activity.

    • PTM

    • Contains three disulfide bonds

Literature Information

  • ·Literature 1

    • Title

    • Isolation, characterization, cDNA cloning, and antimicrobial properties of two distinct subfamilies of alpha-defensins from rhesus macaque leukocytes.

    • Reference

    • Infect Immun. 1999 Nov;67(11):6139-6144.

    • Author

    • Tang YQ, Yuan J, Miller CJ, Selsted ME.