General Information

    • DRAMP ID

    • DRAMP02665

    • Peptide Name

    • Defensin-7 (Defensin, alpha 7; primates, mammals, animals)

    • Source

    • Pan troglodytes (chimpanzee)

    • Family

    • Not found

    • Gene

    • DEFA7

    • Sequence

    • EPLQARADEMPAQKQPPADDQDVVIYFSGDDSSSLQVPGSTKGLICHCRVLYCLFGEHLGGTSFIHGERYPICCY

    • Sequence Length

    • 75

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02665 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02665.

Physicochemical Information

    • Formula

    • C362H551N97O113S6

    • Absent Amino Acids

    • NW

    • Common Amino Acids

    • GDLPS

    • Mass

    • 8262.3

    • PI

    • 4.8

    • Basic Residues

    • 8

    • Acidic Residues

    • 10

    • Hydrophobic Residues

    • 21

    • Net Charge

    • -2

    • Boman Index

    • -106.33

    • Hydrophobicity

    • -0.261

    • Aliphatic Index

    • 72.8

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6210

    • Absorbance 280nm

    • 83.92

    • Polar Residues

    • 24

DRAMP02665

DRAMP02665 chydropathy plot

Comments Information

    • Function

    • Has antimicrobial activity (By similarity).

    • Miscellaneous

    • The human orthologous protein seems not to exist, its coding region does not have a start codon.

    • PTM

    • Problely contains two disulfide bonds.

Literature Information

  • ·Literature 1

    • Title

    • Rapid evolution and diversification of mammalian alpha-defensins as revealed by comparative analysis of rodent and primate genes.

    • Reference

    • Physiol Genomics. 2004 Dec 15;20(1):1-11.

    • Author

    • Patil A, Hughes AL, Zhang G.